Description
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research[1][2].—–C178H286N52O50S7.xC2HF3O2—-[1]Bartok A, et al. Margatoxin is a non-selective inhibitor of human Kv1.3 K<sup>+</sup> channels. Toxicon. 2014 Sep;87:6-16.|[2]Chen YC, et al. PreImplantation factor prevents atherosclerosis via its immunomodulatory effects without affecting serum lipids. Thromb Haemost. 2016 May 2;115(5):1010-24.—-4178.95 (free base)—-[TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH(Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36) (TFA salt)]–Neurological Disease–10 mM in DMSO–Potassium Channel—-Membrane Transporter/Ion Channel–Peptides
Did you check our products for animal nutrition?