β-Amyloid (1-42), (rat/mouse) (TFA)-5 mg

Description
β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer’s disease.–80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)–Neuroscience-Neurodegeneration–C199H307N53O59S.xC2HF3O2—-[1]Stefania Sabella, et al. Capillary electrophoresis studies on the aggregation process of beta-amyloid 1-42 and 1-40 peptides. Electrophoresis. 2004 Oct;25(18-19):3186-94.|[2]Mozes E, et al. A novel method for the rapid determination of beta-amyloid toxicity on acute hippocampal slices using MTT and LDH assays. Brain Res Bull. 2012 Apr 10;87(6):521-5.|[3]Lagunes T, et al. Abeta(1-42) induces abnormal alternative splicing of tau exons 2/3 in NGF-induced PC12 cells. An Acad Bras Cienc. 2014 Dec;86(4):1927-34.|[4]Chennakesavan Karthick, et al. Time-dependent effect of oligomeric amyloid-β (1-42)-induced hippocampal neurodegeneration in rat model of Alzheimer’s disease. Neurol Res. 2019 Feb;41(2):139-150. —-4418.02 (free acid)–99.26–[DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (TFA salt)]–Neurological Disease–DMSO : 55 mg/mL (ultrasonic)–Amyloid-β—-Neuronal Signaling–Peptides