Description
(D-Asp1)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer’s disease[1].—–C203H311N55O60S—-[1]Poduslo JF, Curran GL, Sanyal B, Selkoe DJ. Receptor-mediated transport of human amyloid beta-protein 1-40 and 1-42 at the blood-brain barrier. Neurobiol Dis. 1999 Jun;6(3):190-9.–1802086-19-6–4514.04—-[{d-Asp}-EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA]–Neurological Disease–10 mM in DMSO–Amyloid-β—-Neuronal Signaling–Peptides




Did you check our products for animal nutrition?