ELA-32(human) (TFA)-5 mg

5 mg

SKU: HY-P2196A-5 mg Category: Tags: ,

Description

ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.–80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture and light, under nitrogen)—-C170H289N63O39S4.xC2HF3O2——–3967.82 (free acid)–99.27–[QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22) (TFA salt)]–Cancer–H2O : 100 mg/mL (ultrasonic)–Apelin Receptor (APJ)—-GPCR/G Protein–Peptides

Brand

MEDCHEM EXPRESS