β-CGRP, human (TFA)-1 mg

1 mg

SKU: HY-P1548A-1 mg Category: Tags: ,

Description

β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells[1].–80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)–COVID-19-immunoregulation–C162H267N51O48S3.xC2HF3O2—-[1]McLatchie LM, et al. RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor. Nature. 1998 May 28;393(6683):333-9.|[2]Russell FA, et al. Calcitonin gene-related peptide: physiology and pathophysiology. Physiol Rev. 2014 Oct;94(4):1099-142.—-3793.41 (free base)–99.42–[ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7) (TFA salt)]–Inflammation/Immunology; Cardiovascular Disease–H2O : 100 mg/mL (ultrasonic)–CGRP Receptor—-GPCR/G Protein;Neuronal Signaling–Peptides

Brand

MEDCHEM EXPRESS