β-Amyloid (42-1), human (TFA)-5 mg

Description

β-Amyloid (42-1), human TFA is the inactive form of Amyloid β Peptide (1-42). β-Amyloid (42-1), human TFA is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease[1].–80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)–Neuroscience-Neurodegeneration–N/A—-[1]Schilling T, et al. Amyloid-β-induced reactive oxygen species production and priming are differentially regulated by ion channels in microglia. J Cell Physiol. 2011 Dec;226(12):3295-302.—-N/A—-[AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD (TFA salt)]–Neurological Disease–H2O : 100 mg/mL (ultrasonic)–Amyloid-β—-Neuronal Signaling–Peptides